HIPK2 (Homeodomain Interacting Protein Kinase 2, DKFZp686K02111, FLJ23711, PRO0593)

Größe

£685.00

SKU:: 247093
Reinheit:: Purified
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: HIPK2 (AAG41236.1, 961aa-1065aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Klon:: 4000
Format:: Supplied as a liquid in PBS, pH 7.4.
Weitere Details:: HIPK2 is a conserved serine/threonine nuclear kinase that interacts with homeodomain transcription factors.[supplied by OMIM Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: TGNPRTIIVPPLKTQASEVLVECDSLVPVNTSHHSSSYKSKSSSNVTSTSGHSSGSSSGAITYRQQRPGPHFQQQQPLNLSQAQQHITTDRTGSHRRQQAYITPT Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.