HIC1 (Hypermethylated in Cancer 1, ZBTB29, hic-1)

Größe

£698.00

SKU:: 247076
Reinheit:: Ascites
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: HIC1 (NP_006488.2, 627aa-705aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Klon:: 2C1
Format:: Supplied as a liquid.
Weitere Details:: Mouse monoclonal antibody raised against a partial recombinant HIC1. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: PEGVFAVARLTAEQLSLKQQDKMouse monoclonal antibody raised against a partial recombinant HIC1.AELLAQTTHFLHDPKVALESLYPLAKFTAELGLSPDKAAEVLSQGAHLAAGPDG Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.