HEY1 (Hairy/Enhancer-of-Split Related with YRPW Motif 1, BHLHb31, CHF2, HERP2, HESR1, HRT-1, MGC1274, OAF1)

Größe

£685.00

SKU:: 247039
Reinheit:: Purified
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: HEY1 (NP_036390, 181aa-288aa) full length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Klon:: 300000
Format:: Supplied as a liquid in PBS, pH 7.4.
Weitere Details:: This gene encodes a nuclear protein belonging to the hairy and enhancer of split-related (HESR) family of basic helix-loop-helix (bHLH)-type transcriptional repressors. Expression of this gene is induced by the Notch and c-Jun signal transduction pathways. Two similar and redundant genes in mouse are required for embryonic cardiovascular development, and are also implicated in neurogenesis and somitogenesis. Alternative splicing results in multiple transcript variants. [provided by RefSeq Applications: Suitable for use in ELISA, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: GTVFGHHPHIAHPLLLPQNGHGNAGTTASPTEPHHQGRLGSAHPEAPALRAPPSGSFGPVLPVVTSASKLSLPLLSSVASLSAFPFSFGSFHLLSPNALSPSAPTQAA Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.