246892
H1FOO (H1 Histone Family, Member O, oocyte-Specific, MGC50807, osH1)
Größe
£685.00
- SKU:
- 246892
- Reinheit:
- Ascites
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- H1FOO (AAH47943, 1aa-207aa) full-length human protein.
- Format:
- Supplied as a liquid. No preservative added.
- Weitere Details:
- Mouse polyclonal antibody raised against a full-length human H1FOO protein. Applications: Suitable for use in Immunofluorescence, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MAPATAPRRAGEAKGKGPKKPSEAKEDPPNVGKVKKAAKRPAKVQKPPPKPGAATEKARKQGGAAKDTRAQSGEARKVPPKPDKAMRAPSSAGGLSRKAKAKGSRSSQGDAEAYRKTKAESKSSKPTASKVKNGAASPTKKKVVAKAKAPKAGQGPNTKMouse polyclonal antibody raised against a full-length human H1FOO protein.PAKGSGSKVVPAHLSRKTEAPKGPRKAGLPIKASSSKVSSQRAEA Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice