GPT2 (Glutamic Pyruvate Transaminase (alanine Aminotransferase) 2, ALT2)

Größe

£685.00

SKU:: 246745
Reinheit:: Purified
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: GPT2 (NP_597700, 358aa-456aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Klon:: 7A11
Format:: Supplied as a liquid in PBS, pH 7.4.
Weitere Details:: GPT (MIM 138200) and GPT2 (EC 2.6.1.2), also known as alanine transaminases, are pyridoxal enzymes that catalyze the reversible transamination between alanine and 2-oxoglutarate to form pyruvate and glutamate. By mediating the conversion of these 4 major intermediate metabolites, these transaminases have roles in gluconeogenesis and in amino acid metabolism.[supplied by OMIM Applications: Suitable for use in Immunofluorescence, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: NLHPEIKGQLVKLLSVRLCPPVSGQAAMDIVVNPPVAGEESFEQFSREKESVLGNLAKKAKLTEDLFNQVPGIHCNPLQGAMYAFPRIFIPAKAVEAAQ Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.