246507-BIOTIN

GBX2 (Gastrulation Brain Homeobox 2) (Biotin)

Größe

£914.00

SKU:: 246507-BIOTIN
Reinheit:: Purified
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: GBX2 (NP_001476, 114aa-182aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Klon:: 1C11
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Weitere Details:: Mouse monoclonal antibody raised against a partial recombinant GBX2. Applications: Suitable for use in Immunofluorescence, ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: ASPQHQEMouse monoclonal antibody raised against a partial recombinant GBX2.ARKFAPQPLPGGGNFDKAEALQADAEDGKGFLAKEGSLLAFSAAETVQASLVGAVRGQG Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.