246449
GAL (galanin prepropeptide, GALN, GLNN, GMAP, MGC40167)
Größe
£698.00
- SKU:
- 246449
- Reinheit:
- Ascites
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- GAL (AAH30241, 1aa-123aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 3C1-G5
- Format:
- Supplied as a liquid.
- Weitere Details:
- Galanin is small neuropeptide that functions as a cellular messenger within the central and peripheral nervous systems, modulating diverse physiologic functions (Mechenthaler, 2008 [PubMed 18500643]).[supplied by OMIM Applications: Suitable for use in ELISA, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MARGSALLLASLLLMouse monoclonal antibody raised against a full-length recombinant GAL.LSASAGLWSPAKEKRGWTLNSAGYLLGPHAVGNHRSFSDKNGLTSKRELRPEDDMKPGSFDRSIPENNIMRTIIEFLSFLHLKEAGALDRLLDLPMouse monoclonal antibody raised against a full-length recombinant GAL.SSEDIERS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice