FXC1 (Fracture Callus 1 Homolog (rat), TIM10B, TIMM10B, Tim9b)

Größe

£685.00

SKU:: 246407
Anwendung:: WB
Reinheit:: Ascites
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: FXC1 (AAH11014.1, 1aa-103aa) full-length human protein.
Format:: Supplied as a liquid. No preservative added.
Weitere Details:: FXC1, or TIMM10B, belongs to a family of evolutionarily conserved proteins that are organized in heterooligomeric complexes in the mitochondrial intermembrane space. These proteins mediate the import and insertion of hydrophobic membrane proteins into the mitochondrial inner membrane.[supplied by OMIM Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MERQQQQQQQLRNLRDFLLVYNRMTELCFQRCVPSLHHRALDAEEEACLHSCVGKLIHSNHRLMAAYVQLMPALVQRRIADYEAASAVPSVAAEQPGVSPSGS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.