246290-PE

FOXL1 (Forkhead Box L1, FKH6, FKHL11, FREAC7) (PE)

Größe

£914.00

SKU:: 246290-PE
Reinheit:: Purified
Lagerbedingungen:: 4°C Do Not Freeze
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: FOXL1 (NP_005241, 132aa-240aa) full length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Klon:: 2000000
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Weitere Details:: Mouse monoclonal antibody raised against a full length recombinant FOXL1. Applications: Suitable for use in FLISA, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MFENGNYRRRKRKPKPGPGAPEAKRPRAETHQRSAEAQPEAGSGAGGSGPAISRLQAAPAGPSPLLDGPSPPAPLHWPGTASPNEDAGDAAQGMouse monoclonal antibody raised against a full length recombinant FOXL1.VAVGQAARTGDGP Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.