246270
FOXC2 (Forkhead Box C2 (MFH-1, Mesenchyme Forkhead 1), FKHL14, LD, MFH-1, MFH1)
Größe
£685.00
- SKU:
- 246270
- Reinheit:
- Purified
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- FOXC2 (NP_005242, 156aa-256aa) full length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 4A5
- Format:
- Supplied as a liquid in PBS, pH 7.4.
- Weitere Details:
- This gene belongs to the forkhead family of transcription factors which is characterized by a distinct DNA-binding forkhead domain. The specific function of this gene has not yet been determined; however, it may play a role in the development of mesenchymal tissues. [provided by RefSeq Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: FENGSFLRRRRRFKKKDVSKEKEERAHLKEPPPAASKGAPATPHLADAPKEAEKKVVIKSEAASPALPVITKVETLSPESALQGSPRSAASTPAGSPDGSL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice