246260-PE
FOXC1 (Forkhead Box C1, ARA, FKHL7, FREAC-3, FREAC3, IGDA, IHG1, IRID1) (PE)
Größe
£914.00
- SKU:
- 246260-PE
- Reinheit:
- Purified
- Lagerbedingungen:
- 4°C Do Not Freeze
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- FOXC1 (NP_001444, 464aa-553aa) full length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 1.0e+11
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
- Weitere Details:
- This gene belongs to the forkhead family of transcription factors which is characterized by a distinct DNA-binding forkhead domain. The specific function of this gene has not yet been determined; however, it has been shown to play a role in the regulation of embryonic and ocular development. Mutations in this gene cause various glaucoma phenotypes including primary congenital glaucoma, autosomal dominant iridogoniodysgenesis anomaly, and Axenfeld-Rieger anomaly. [provided by RefSeq Applications: Suitable for use in FLISA, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: AAHQGRLTSWYLNQAGGDLGHLASMouse monoclonal antibody raised against a full length recombinant FOXC1.Mouse monoclonal antibody raised against a full length recombinant FOXC1.AAGYPGQQQNFHSVREFESQRIGLNNSPVNGNSSCQMAFPSSQSLYRTSGAFVYDCSKF* Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice