245866-APC

EXOSC4 (exosome Component 4, FLJ20591, RRP41, RRP41A, Rrp41p, SKI6, Ski6p, hRrp41p, p12A) (APC)

Größe

£914.00

SKU:: 245866-APC
Reinheit:: Purified
Lagerbedingungen:: 4°C Do Not Freeze
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: EXOSC4 (NP_061910.1, 1aa-100aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Klon:: 4F9
Format:: Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
Weitere Details:: Mouse monoclonal antibody raised against a partial recombinant EXOSC4. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MAGLELLSDQGYRVDGRRAGELRKIQARMGVFAQADGSAYIEQGNTKALAVVYGPHEIRGSRARALPDRALVNCQYSSATFSTGERKRRPHGDRKSCEMG Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.