245795-APC
EPOR (Erythropoietin Receptor, MGC138358) (APC)
Größe
£914.00
- SKU:
- 245795-APC
- Reinheit:
- Purified
- Lagerbedingungen:
- 4°C Do Not Freeze
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- EPOR (NP_000112, 31aa-130aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 3F6
- Format:
- Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
- Weitere Details:
- The erythropoietin receptor is a member of the cytokine receptor family. Upon erythropoietin binding, the erythropoietin receptor activates Jak2 tyrosine kinase which activates different intracellular pathways including: Ras/MAP kinase, phosphatidylinositol 3-kinase and STAT transcription factors. The stimulated erythropoietin receptor appears to have a role in erythroid cell survival. Defects in the erythropoietin receptor may produce erythroleukemia and familial erythrocytosis. [provided by RefSeq. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: PDPKFESKAALLAARGPEELLCFTERLEDLVCFWEEAASAGVGPGNYSFSYQLEDEPWKLCRLHQAPTARGAVRFWCSLPTADTSSFVPLELRVTAASGA Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice