245663
EIF4G2 (Eukaryotic Translation Initiation Factor 4 gamma, 2, AAG1, DAP5, FLJ41344, NAT1, p97)
Größe
£685.00
- SKU:
- 245663
- Reinheit:
- Purified
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Partial recombinant protein corresponding to aa811-889 from human EIF4G2 with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 30000
- Format:
- Supplied as a liquid in PBS, pH 7.4.
- Weitere Details:
- Translation initiation is mediated by specific recognition of the cap structure by eukaryotic translation initiation factor 4F (eIF4F), which is a cap binding protein complex that consists of three subunits: eIF4A, eIF4E and eIF4G. The protein encoded by this gene shares similarity with the C-terminal region of eIF4G that contains the binding sites for eIF4A and eIF3; eIF4G, in addition, contains a binding site for eIF4E at the N-terminus. Unlike eIF4G, which supports cap-dependent and independent translation, this gene product functions as a general repressor of translation by forming translationally inactive complexes. In vitro and in vivo studies indicate that translation of this mRNA initiates exclusively at a non-AUG (GUG) codon. Alternatively spliced transcript variants encoding different isoforms of this gene have been described. [provided by RefSeq Applications: Suitable for use in Immunofluorescence, ELISA, and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence (IC): 10ug/ml Optimal dilutions to be determined by the researcher. AA Sequence: SFKPVMQKFLHDHVDLQVSALYALQVHCYNSNFPKGMLLRFFVHFYDMEIIEEEAFLAWKEDITQEFPGKGKALFQVNQ Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice