EIF4E2 (Eukaryotic Translation Initiation Factor 4E Family Member 2, 4E-LP, 4EHP, EIF4EL3, IF4e)

Größe

£685.00

SKU:: 245657
Reinheit:: Purified
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: EIF4E2 (AAH05874, 1aa-245aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Klon:: 1F3
Format:: Supplied as a liquid in PBS, pH 7.4.
Weitere Details:: Mouse monoclonal antibody raised against a full-length recombinant EIF4E2. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MNNKFDALKDDDSGDHDQNEENSTQKDGEKEKTERDKNQSSSKRKAVVPGPAEHPLQYNYTFWYSRRTPGRPTSSQSYEQNIKQIGTFASVEQFWRFYSHMVRPGDLTGHSDFHLFKEGIKPMWEDDANKNGGKWIIRLRKGLASRCWENLILAMLGEQFMVGEEICGAVVSVRFQEDIISIWNKTASDQATTARIRDTLRRVLNLPPNTIMEYKTHTDSIKMPGRLGPQRLLFQNLWKPRLNVP Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.