DND1 (dead end Homolog 1 (zebrafish), MGC34750, RBMS4)

Größe

£685.00

SKU:: 245452
Reinheit:: Purified
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: DND1 (NP_919225, 167aa-260aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Klon:: 1D3
Format:: Supplied as a liquid in PBS, pH 7.4.
Weitere Details:: Mouse monoclonal antibody raised against a full-length recombinant DND1. Applications: Suitable for use in Immunofluorescence, ELISA, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: EARLLPSPGPAPGQIALLKFSSHRMouse monoclonal antibody raised against a full-length recombinant DND1.MAKKALVEGQSHLCGEQVAVEWLKPDLKQRLRQQLVGPFLRSPQPEGSQLALARDKLGFQGARATLQ Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.