245375
DLG1 (discs, Large Homolog 1 (Drosophila), DKFZp761P0818, DKFZp781B0426, DLGH1, SAP-97, SAP97, dJ1061C18.1.1, hdlg)
Größe
£685.00
- SKU:
- 245375
- Reinheit:
- Purified
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- DLG1 (NP_004078, 1aa-90aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 1B12
- Format:
- Supplied as a liquid in PBS, pH 7.4.
- Weitere Details:
- Mouse monoclonal antibody raised against a partial recombinant DLG1. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MPVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQSNLFQALIDIQEFYEVTLLDNPKCIDRSKPSEPIQPVNTWEISSLPSS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice