DDT (D-dopachrome tautomerase, DDCT)

Größe

£685.00

SKU:: 245249
Reinheit:: Purified
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: DDT (AAH15508, 1aa-118aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Klon:: 1D5
Format:: Supplied as a liquid in PBS, pH 7.4.
Weitere Details:: D-dopachrome tautomerase converts D-dopachrome into 5,6-dihydroxyindole. The DDT gene is related to the migration inhibitory factor (MIF) in terms of sequence, enzyme activity, and gene structure. DDT and MIF are closely linked on chromosome 22. [provided by RefSeq Applications: Suitable for use in Immunoprecipitation. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MPFLELDTNLPANRVPAGLEKRLCMouse monoclonal antibody raised against a full-length recombinant DDT.ASILGKPADRVNVTVRPGLAMALSGSTEPCAQLSISSIGVVGTAEDNRSHSAHFFEFLTKELALGQDRILIRFFPLESWQIGKIGTVMTFL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.