DCUN1D1 (DCN1, Defective in Cullin Neddylation 1, Domain Containing 1 (S. cerevisiae), DCUN1L1, RP42, SCCRO, SCRO, Tes3)

Größe

£685.00

SKU:: 245228
Reinheit:: Purified
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: DCUN1D1 (NP_065691, 1aa-89aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Klon:: 4B5
Format:: Supplied as a liquid in PBS, pH 7.4.
Weitere Details:: Mouse monoclonal antibody raised against a partial recombinant DCUN1D1. Applications: Suitable for use in ELISA, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MNKLKSSQKDKVRQFMIFTQSSEKTAVSCLSQNDWKLDVATDNFFQNPELYIRESVKGSLDRKKLEQLYNRYKDPQDENKIGIDGIQQF Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.