245181
DAB2IP (DAB2 Interacting Protein, AF9Q34, AIP1, DIP1/2, FLJ39072, KIAA1743)
Größe
£685.00
- SKU:
- 245181
- Reinheit:
- Purified
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- DAB2IP (NP_115941.1, 551aa-650aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 8C10
- Format:
- Supplied as a liquid in PBS, pH 7.4.
- Weitere Details:
- DAB2IP is a Ras (MIM 190020) GTPase-activating protein (GAP) that acts as a tumor suppressor gene and is inactivated by methylation in prostate and breast cancers (Yano et al., 2005 [PubMed 15386433]).[supplied by OMIM Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: KSLSMVDLQDARTLDGEAGSPAGPDVLPTDGQMouse monoclonal antibody raised against a partial recombinant DAB2IP.AQLVAGWPARATPVNLAGLATVRRAGQTPTTPGTSEGAPGRPQLLAPLSFQNPVYQMAAGLPLSP Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice