CYLD (Cylindromatosis (Turban Tumor Syndrome), CDMT, CYLD1, CYLDI, EAC, FLJ20180, FLJ31664, FLJ78684, HSPC057, KIAA0849, MFT, MFT1, SBS, TEM, USPL2)

Größe

£685.00

SKU:: 245139
Reinheit:: Purified
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: CYLD (AAH12342, 854aa-953aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Klon:: 2G1
Format:: Supplied as a liquid in PBS, pH 7.4.
Weitere Details:: This gene is encodes a cytoplasmic protein with three cytoskeletal-associated protein-glycine-conserved (CAP-GLY) domains that functions as a deubiquitinating enzyme. Mutations in this gene have been associated with cylindromatosis, multiple familial trichoepithelioma, and Brooke-Spiegler syndrome. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: QNMELFAVLCIETSHYVAFVKYGKDDSAWLFFDSMADRDGGQNGFNIPQVTPCPEVGEYLKMSLEDLHSLDSRRIQGCARRLLCDAYMCMYQSPTMSLYK Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.