CUEDC1 (CUE Domain Containing 1, DKFZp547L163, FLJ20739)

Größe

£685.00

SKU:: 245086
Reinheit:: Purified
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: CUEDC1 (NP_060419.1, 1aa-386aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Klon:: 4F9
Format:: Supplied as a liquid in PBS, pH 7.4.
Weitere Details:: Mouse monoclonal antibody raised against a full-length recombinant CUEDC1. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MTSLFRRSSSGSGGGGTAGARGGGGGTAAPQELNNSRPARQVRRLEFNQAMDDFKTMFPNMDYDIIECVLRANSGAVDATIDQLLQMNLEGGGSSGGVYEDSSDSEDSIPPEILERTLEPDSSDEEPPPVYSPPAYHMHVFDRPYPLAPPTPPPRIDALGSGAPTSQRRYRNWNPPLLGNLPDDFLRILPQQLDSIQGNAGGPKPGSGEGCPPAMAGPGPGDQESRWKQYLEDERIALFLQNEEFMKELQRNRDFLLALERDRLKYESQKSKSSSVAVGNDFGFSSPVPGTGDANPAVSEDALFRDKLKHMGKSTRRKLFELARAFSEKTKMRKSKRKHLLKHQSLGMouse monoclonal antibody raised against a full-length recombinant CUEDC1.STANLLDDVEGHACDEDFRGRRQEAPKVEEGLREGQ Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.