CPNE5 (Copine V, COPN5, CPN5, DKFZp666C234, KIAA1599)

Größe

£698.00

SKU:: 244892
Reinheit:: Ascites
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: CPNE5 (NP_065990, 393aa-450aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Klon:: 2G4
Format:: Supplied as a liquid.
Weitere Details:: Calcium-dependent membrane-binding proteins may regulate molecular events at the interface of the cell membrane and cytoplasm. This gene is one of several genes that encode a calcium-dependent protein containing two N-terminal type II C2 domains and an integrin A domain-like sequence in the C-terminus. Sequence analysis identified multiple alternatively spliced transcript variants but their full-length natures could not be determined. [provided by RefSeq Applications: Suitable for use in ELISA, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: RVSHEFPLNGNQENPSCCGIDGILEAYHRSLRTVQLYGPTNFAPVVTHVARNMouse monoclonal antibody raised against a partial recombinant CPNE5.VQD Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.