CHP (Calcium Binding Protein P22, SLC9A1BP)

Größe

£698.00

SKU:: 244683
Reinheit:: Ascites
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: CHP (AAH08373, 1aa-66aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Klon:: 3G8
Format:: Supplied as a liquid.
Weitere Details:: This gene encodes a phosphoprotein that binds to the Na+/H+ exchanger NHE1. This protein serves as an essential cofactor which supports the physiological activity of NHE family members and may play a role in the mitogenic regulation of NHE1. The protein shares similarity with calcineurin B and calmodulin and it is also known to be an endogenous inhibitor of calcineurin activity. [provided by RefSeq Applications: Suitable for use in ELISA, Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MESHSVTQAGVQWRDLGSLQPLPPGFKQFSHLSLPSSWDYRRVPPYLGNFCIFSGEGVSPCWPGWS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.