244551
CDKN2D (Cyclin-Dependent Kinase Inhibitor 2D (p19, inhibits CDK4), INK4D, p19, p19-INK4D)
Größe
£685.00
- SKU:
- 244551
- Reinheit:
- Purified
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- CDKN2D (AAH01822, 1aa-166aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 2.0e+10
- Format:
- Supplied as a liquid in PBS, pH 7.4.
- Weitere Details:
- Mouse monoclonal antibody raised against a full-length recombinant CDKN2D. Applications: Suitable for use in Western Blot, Immunoprecipitation. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MLLEEVRAGDRLSGMouse monoclonal antibody raised against a full-length recombinant CDKN2D.RGDVQEVRRLLHRELVHPDALNRFGKTALQVMMFGSTAIALELLKQGVSPNVQDTSGTSPVHDAARTGFLDTLKVLVEHGADVNVPDGTGALPIHLAVQEGHTAVVSFLAAESDLHRRDARGLTPLELALQRGAQDLVDILQGHMVAPL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice