CD40 (CD40 Molecule, TNF Receptor Superfamily Member 5, Bp50, CDW40, MGC9013, TNFRSF5, p50)

Größe

£685.00

SKU:: 244394
Reinheit:: Purified
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: CD40 (AAH12419, 21aa-193aa) partial recombinant protein with GST tag.
Klon:: 6H1
Format:: Supplied as a liquid in PBS, pH 7.4.
Weitere Details:: Mouse monoclonal antibody raised against a partial recombinant CD40. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLR Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.