CCL3 (Chemokine (C-C Motif) Ligand 3, G0S19-1, LD78ALPHA, MIP-1-alpha, MIP1A, SCYA3)

Größe

£685.00

SKU:: 244318
Reinheit:: Purified
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: CCL3 (NP_002974, 24aa-92aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Klon:: 2.0e+9
Format:: Supplied as a liquid in PBS, pH 7.4.
Weitere Details:: Macrophage inflammatory protein-1 is a so-called monokine that is involved in the acute inflammatory state in the recruitment and activation of polymorphonuclear leukocytes (Wolpe et al., 1988 [PubMed 3279154]). Sherry et al. (1988) [PubMed 3058856] demonstrated 2 protein components of MIP1, called by them alpha and beta.[supplied by OMIM Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: SLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.