244224
CAPZB (Capping Protein (Actin Filament) Muscle Z-line, beta, CAPB, CAPPB, CAPZ, MGC104401, MGC129749, MGC129750)
Größe
£685.00
- SKU:
- 244224
- Anwendung:
- WB
- Reinheit:
- Ascites
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- CAPZB (AAH08095.1, 1aa-79aa) full-length human protein.
- Format:
- Supplied as a liquid. No preservative added.
- Weitere Details:
- CAPZB is a member of the F-actin capping protein family. This gene encodes the beta subunit of the barbed-end actin binding protein. The protein regulates growth of the actin filament by capping the barbed end of growing actin filaments. [provided by RefSeq Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MLNLCFMLTRHAVHSLDSFLRKLVFCSLPSSLPSPTGHITAASLTAQRHLSLRIKPIATLLRLRACFCHTSLSVLSTFP Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice