243572
ATF2 (Activating Transcription Factor 2, CRE-BP1, CREB2, HB16, MGC111558, TREB7)
Größe
£685.00
- SKU:
- 243572
- Reinheit:
- Purified
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- ATF2 (NP_001871, 91aa-190aa) full length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 3A3
- Format:
- Supplied as a liquid in PBS, pH 7.4.
- Weitere Details:
- This gene encodes a transcription factor that is a member of the leucine zipper family of DNA binding proteins. This protein binds to the cAMP-responsive element (CRE), an octameric palindrome. The protein forms a homodimer or heterodimer with c-Jun and stimulates CRE-dependent transcription. The protein is also a histone acetyltransferase (HAT) that specifically acetylates histones H2B and H4 in vitro; thus it may represent a class of sequence-specific factors that activate transcription by direct effects on chromatin components. Additional transcript variants have been identified but their biological validity has not been determined. [provided by RefSeq Applications: Suitable for use in ELISA, Western Blot, In situ Proximity Ligation Assay (Cell). Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: PFENEFKKASEDDIKKMPLDLSPLATPIIRSKIEEPSVVETTHQDSPLPHPESTTSDEKEVPLAQTAQPTSAIVRPASLQVPNVLLTSSDSSVIIQQAVP* Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice