ARL13B (ADP-Ribosylation Factor-like 13B, ARL2L1, DKFZp686E2075, DKFZp686L2472, DKFZp686M2074, DKFZp761H079, JBTS8, MGC120611, MGC120612)

Größe

£685.00

SKU:: 243475
Reinheit:: Purified.
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Partial recombinant protein corresponding to aa329-428 of human ARL13B with GST tag. MW of the GST tag alone is 26kD.
Klon:: 6F11
Format:: Supplied as a liquid in PBS, pH 7.4.
Weitere Details:: Mouse monoclonal antibody raised against a partial recombinant ARL13B. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Amino Acid Sequence: KNEDETDRPSLESANGKKKTKKLRMKRNHRVEPLNIDDCAPESPTPPPPPPPVGWGTPKVTRLPKLEPLGETHHNDFYRKPLPPLAVPQRPNSDAHDVIS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.