ARHGEF10 (Rho Guanine Nucleotide Exchange Factor (GEF) 10, DKFZp686H0726, GEF10, MGC131664)

Größe

£685.00

SKU:: 243461
Reinheit:: Purified
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: ARHGEF10 (NP_055444, 792aa-890aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Klon:: 6G5
Format:: Supplied as a liquid in PBS, pH 7.4.
Weitere Details:: Rho GTPases play a fundamental role in numerous cellular processes that are initiated by extracellular stimuli that work through G protein coupled receptors. The encoded protein may form complex with G proteins and stimulate Rho-dependent signals. [provided by RefSeq Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: GKQDKSGRPTFFTAVFNTFTPAIKESWVNSLQMAKLALEEENHMGWFCVEDDGNHIKKEKHPLLVGHMPVMVAKQQEFKIECAAYNPEPYLNNESQPDS Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.