ARFGEF1 (ADP-Ribosylation Factor Guanine Nucleotide-Exchange Factor 1(brefeldin A-inhibited), ARFGEP1, BIG1, D730028O18Rik, DKFZP434L057, P200)

Größe

£685.00

SKU:: 243439
Reinheit:: Purified
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: ARFGEF1 (NP_006412.2, 311aa-411aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Klon:: 3.0e+11
Format:: Supplied as a liquid in PBS, pH 7.4.
Weitere Details:: ADP-ribosylation factors (ARFs) play an important role in intracellular vesicular trafficking. The protein encoded by this gene is involved in the activation of ARFs by accelerating replacement of bound GDP with GTP. It contains a Sec7 domain, which may be responsible for the guanine-nucleotide exchange activity and also the brefeldin A inhibition. [provided by RefSeq Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: EVLYDGENHDCEEKPQDIVQNIVEEMVNIVVGDMGEGTTINASADGNIGTIEDGSDSENIQANGIPGTPISVAYTPSLPDDRLSVSSNDTQESGNSSGPSP Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.