243134
AGAP1 (ArfGAP with GTPase Domain, Ankyrin Repeat and PH Domain 1, CENTG2, GGAP1, KIAA1099, MGC71657)
Größe
£685.00
- SKU:
- 243134
- Reinheit:
- Purified
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- AGAP1 (NP_055729.2, 672aa-781aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 3F2
- Format:
- Supplied as a liquid in PBS, pH 7.4.
- Weitere Details:
- CENTG2 belongs to an ADP-ribosylation factor GTPase-activating (ARF-GAP) protein family involved in membrane traffic and actin cytoskeleton dynamics (Nie et al., 2002 [PubMed 12388557]).[supplied by OMIM Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: LPCTELSLGQHLLRATADEDLRTAILLLAHGSRDEVNETCGEGDGRTALHLACRKGNVVLAQLLIWYGVDVTARDAHGNTALAYARQASSQECIDVLLQYGCPDERFVLM Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice