ABTB1 (Ankyrin Repeat and BTB (POZ) Domain Containing 1, BPOZ, Btb3, EF1ABP, MGC20585, PP2259)

Größe

£685.00

SKU:: 243008
Reinheit:: Purified
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: ABTB1 (NP_742024, 271aa-370aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Klon:: 2A10
Format:: Supplied as a liquid in PBS, pH 7.4.
Weitere Details:: This gene encodes a protein with an ankyrin repeat region and two BTB/POZ domains, which are thought to be involved in protein-protein interactions. Expression of this gene is activated by the phosphatase and tensin homolog, a tumor suppressor. Alternate splicing results in three transcript variants encoding different isoforms. [provided by RefSeq Applications: Suitable for use in Immunofluorescence, ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: CPDICFRVAGCSFLCHKAFFCGRSDYFRALLDDHFRESEEPATSGGPPAVTLHGISPDVFTHVLYYMYSDHTELSPEAAYDVLSVADMYLLPGLKRLCGR Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.