ABO (ABO Blood Group (Transferase A, alpha 1-3-N-acetylgalactosaminylTransferase; Transferase B, alpha 1-3-galactosylTransferase), A3GALNT, A3GALT1, GTB, NAGAT)

Größe

£685.00

SKU:: 243001
Reinheit:: Purified
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: ABO (NP_065202.2, 273aa-354aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Klon:: 1B7
Format:: Supplied as a liquid in PBS, pH 7.4.
Weitere Details:: This gene encodes proteins related to the first discovered blood group system, ABO. Which allele is present in an individual determines the blood group. The 'O' blood group is caused by a deletion of guanine-258 near the N-terminus of the protein which results in a frameshift and translation of an almost entirely different protein. Individuals with the A, B, and AB alleles express glycosyltransferase activities that convert the H antigen into the A or B antigen. Other minor alleles have been found for this gene. [provided by RefSeq Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: SVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVPKNHQAVRNP Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.