PACAP-27, Amide, Sheep (Pituitary Adenylate Cyclase Activating Polypeptide, HSDGIFTDSYSRYRKQMAVKKYLAAVL-NH2)

Größe

£741.00

SKU:: 217620
Molekulargewicht:: 3147.7
Reinheit:: ≥98% (HPLC)
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
CAS Number:: 127317-03-7
Format:: Supplied as an off-white solid.
Weitere Details:: Increases cAMP levels in a dose-dependent manner (EC50=4.7nM). Increases tyrosine hydroxylase expression in chromaffin cells. CAS No: 127317-03-7 Synonyms: Pituitary Adenylate Cyclase Activating Polypeptide, HSDGIFTDSYSRYRKQMAVKKYLAAVL-NH₂ Sequence: H-His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-NH2 Molecular Formula: C₁₄₂H₂₂₄N₄₀O₃₉S Molecular Weight: 3147.7 Solubility: 5% acetic acid (1mg/ml) Primary Target: Increases cAMP levels Cell permeable: No Form: Supplied as a trifluoroacetate salt. Appearance: White to off-white solid Purity: ≥98% (HPLC) Storage and Stability: Lyophilized powder may be stored at -20°C. Stable for 12 months after receipt at -20°C. Reconstitute with sterile buffer or ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.