207911

TAOK2 (TAO Kinase 2, KIAA0881, MAP3K17, PSK, PSK1, TAO1, TAO2)

Größe

£685.00

SKU:: 207911
Reinheit:: Purified
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Recombinant protein corresponding to aa831-930 from human TAOK2 with GST tag. MW of the GST tag alone is 26kD.
Klon:: 3E2
Format:: Supplied as a liquid in PBS, pH 7.4.
Weitere Details:: TAO kinase 2 (Serine/threonine-protein kinase TAO2) belongs to the MAP kinase family. It activates the JNK MAP kinase pathway through the specific activation of the MAP2Ks MEK3 and MEK6. TAO kinase 2 mediates signaling from carbachol, relaying signals from carbachol through heterotrimeric G proteins to the p38 MAP kinase and ternary complex factors. It alters actin cytoskeletal organization and interacts with microtubules affecting their organization and stability independently of TAO kinase activity. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: ELQCRQYKRKMLLARHSLDQDLLREDLNKKQTQKDLECALLLRQHEATRELELRQLQAVQRTRAELTRLQHQTELGNQLEYNKRREQELRQKHAAQVRQQ Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.