207905
STK4 (Serine/Threonine Kinase 4, OTTHUMP00000043418, DJ211D12.2 (Serine/Threonine Kinase 4 (MST1, KRS2)), Kinase Responsive to Stress 2, Mammalian Sterile 20-like 1, Yeast Ste20-like, DKFZp686A2068, KRS2, MST1, YSK3)
Größe
£685.00
- SKU:
- 207905
- Reinheit:
- Purified
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Recombinant protein corresponding to aa391-485 from human STK4 with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 4F4
- Format:
- Supplied as a liquid in PBS, pH 7.4.
- Weitere Details:
- The protein encoded by this gene is a cytoplasmic kinase that is structurally similar to the yeast Ste20p kinase, which acts upstream of the stress-induced mitogen-activated protein kinase cascade. The encoded protein can phosphorylate myelin basic protein and undergoes autophosphorylation. A caspase-cleaved fragment of the encoded protein has been shown to be capable of phosphorylating histone H2B. The particular phosphorylation catalyzed by this protein has been correlated with apoptosis, and it's possible that this protein induces the chromatin condensation observed in this process. Applications: Suitable for use in Immunofluorescence, ELISA, Western Blot and In situ Proximity Ligation Assay. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: AKPSFLEYFEQKEKENQINSFGKSVPGPLKNSSDWKIPQDGDYEFLKSWTVEDLQKRLLALDPMMEQEIEEIRQKYQSKRQPILDAIEAKKRRQQ Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice