207799

MPG (N-methylpurine-DNA Glycosylase, 3' End of the Mid1 Gene, Localized 68kb Upstream the humanzeta Globin Gene on 16p, CRA36.1 (3-methyl-adenine DNA Glycosylase),N-methylpurine-DNA Glycosylase, MPG, Alkyladenine DNA Glycosylase, Proliferation-inducing Protein 11, Proliferation-inducing Protein, AAG, APNG, CRA36.1, MDG, Mid1, PIG11, PIG16)

Größe

£685.00

SKU:: 207799
Reinheit:: Purified
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Recombinant protein corresponding to aa1-90 from human MPG with GST tag. MW of the GST tag alone is 26kD.
Klon:: 2C5
Format:: Supplied as a liquid in PBS, pH 7.4.
Weitere Details:: Hydrolysis of the deoxyribose N-glycosidic bond to excise 3-methyladenine, and 7-methylguanine from the damaged DNA polymer formed by alkylation lesions. Applications: Suitable for use in Immunofluorescence, ELISA, Western Blot and Immunohistochemistry. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MPARSGAQFCRRMGQKKQRPARAGQPHSSSDAAQAPAEQPHSSSDAAQAPCPRERCLGPPTTPGPYRSIYFSSPKGHLTRLGLEFFDQPA Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.