207794

MEOX2 (Mesenchyme Homeobox 2, Growth arrest-specific Homeo box, Mesenchyme Homeo box 2 (Growth arrest-specific Homeo box), GAX, MOX2)

Größe

£685.00

SKU:: 207794
Reinheit:: Purified
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Recombinant protein corresponding to aa1-303 from full-length human MEOX2 with GST tag. MW of the GST tag alone is 26kD.
Klon:: 4B2
Format:: Supplied as a liquid in PBS, pH 7.4.
Weitere Details:: This gene encodes a member of a subfamily of non-clustered, diverged, antennapedia-like homeobox-containing genes. The encoded protein may play a role in the regulation of vertebrate limb myogenesis. Mutations in the related mouse protein may be associated with craniofacial and/or skeletal abnormalities, in addition to neurovascular dysfunction observed in Alzheimer's disease. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MEHPLFGCLRSPHATAQGLHPFSQSSLALHGRSDHM SYPELSTSSSSCIIAGYPNEEGMFASQHHRGHHHHHH HHHHHHQQQQHQALQTNWHLPQMSSPPSAARHSLC LQPDSGGPPELGSSPPVLCSNSSSLGSSTPTGAACAP GDYGRQALSPAEAEKRSGGKRKSDSSDSQEGNYKSE VNSKPRKERTAFTKEQIRELEAEFAHHNYLTRLRRYEI AVNLDLTERQVKVWFQNRRMKWKRVKGGQQGAAAR EKELVNVKKGTLLPSELSGIGAATLQQTGDSIANEDSH DSDHSSEHAHL Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.