207752
KLF9 (Kruppel-like Factor 9, BTEB, BTEB1, OTTHUMP00000021441, Basic Transcription Element Binding Protein 1)
Größe
£685.00
- SKU:
- 207752
- Reinheit:
- Purified
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Recombinant protein corresponding to aa25-101 from human KLF9 with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 2B9
- Format:
- Supplied as a liquid in PBS, pH 7.4.
- Weitere Details:
- The protein encoded by this gene is a transcription factor that binds to GC box elements located in the promoter. Binding of the encoded protein to a single GC box inhibits mRNA expression while binding to tandemly repeated GC box elements activates transcription. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: PEHGVAPDAERLRLPEREVTKEHGDPGDTWKDYCTL VTIAKSLLDLNKYRPIQTPSVCSDSLESPDEDMGSDSD VTT Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice