207751

KLF6 (Kruppel-like Factor 6, B-cell derived 1, Core promoter Element Binding Protein, Core Promoter Element-Binding Protein, N-terminus truncated, Prostate Adenocarcinoma-1, Protooncogene BCD1, Suppression of tumorigenicity 12 (prostate), BCD1, COPEB, CPBP, DKFZp686N0199, GBF, PAC1, ST12, ZF9)

Größe

£685.00

SKU:: 207751
Reinheit:: Purified
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Recombinant protein corresponding to aa1-100 from human KLF6 with GST tag. MW of the GST tag alone is 26kD.
Klon:: 3C4
Format:: Supplied as a liquid in PBS, pH 7.4.
Weitere Details:: This gene encodes a member of the Kruppel-like family of transcription factors. The zinc finger protein is a transcriptional activator, and functions as a tumor suppressor. Multiple transcript variants encoding different isoforms have been found for this gene, some of which are implicated in carcinogenesis. Applications: Suitable for use in Immunofluorescence and ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MDVLPMCSIFQELQIVHETGYFSALPSLEEYWQQTCLE LERYLQSEPCYVSASEIKFDSQEDLWTKIILAREKKEES ELKISSSPPEDTLISPSFCYNLE Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.