207738

ING1 (Inhibitor Of Growth Family, Member 1, Growth Inhibitor ING1, Growth Inhibitory Protein ING1, Inhibitor of Growth 1, Tumor Suppressor ING1, P24ING1c, P33, P33ING1, P33ING1b, P47, P47ING1a)

Größe

£698.00

SKU:: 207738
Reinheit:: Ascites
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Recombinant protein corresponding to aa41-140 from human ING1 with GST tag. MW of the GST tag alone is 26kD.
Klon:: 2E5
Format:: Supplied as a liquid.
Weitere Details:: This gene encodes a tumor suppressor protein that can induce cell growth arrest and apoptosis. The encoded protein is a nuclear protein that physically interacts with the tumor suppressor protein TP53 and is a component of the p53 signaling pathway. Reduced expression and rearrangement of this gene have been detected in various cancers. Multiple alternatively spliced transcript variants encoding distinct isoforms have been reported. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: DAKYQEILKELDECYERFSRETDGAQKRRMLHCVQRA LIRSQELGDEKIQIVSQMVELVENRTRQVDSHVELFEA QQELGDTAGNSGKAGADRPKGEAAA Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.