207690
GUK1 (Guanylate Kinase 1, GMK, OTTHUMP00000037504, OTTHUMP00000037740, OTTHUMP00000037741, OTTHUMP00000037742, OTTHUMP00000037748, OTTHUMP00000037750, OTTHUMP00000061419)
Größe
£698.00
- SKU:
- 207690
- Reinheit:
- Ascites
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Recombinant protein corresponding to aa100-197 from human GUK1 with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 1H3
- Format:
- Supplied as a liquid.
- Weitere Details:
- Essential for recycling GMP and indirectly, cGMP. Applications: Suitable for use in ELISA, Western Blot and Immunoprecipitation. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: LDVDLQGVRNIKATDLRPIYISVQPPSLHVLEQRLRQRNTETEESLVKRLAAAQADMESSKEPGLFDVVIINDSLDQAYAELKEALSEEIKKAQRTGA Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
- Versandbedingungen:
- Blue Ice