207672

GRK4 (G Protein-Coupled Receptor Kinase 4, G Protein-Coupled Receptor Kinase 2-like, G-Protein Coupled Receptor Kinase 4, GPRK2L, GPRK4, GRK4a, IT11)

Größe

£685.00

SKU:: 207672
Reinheit:: Purified
Lagerbedingungen:: -20°C
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Recombinant protein corresponding to aa36-145 from human GRK4 with GST tag. MW of the GST tag alone is 26kD.
Klon:: 4D2
Format:: Supplied as a liquid in PBS, pH 7.4.
Weitere Details:: This gene encodes a member of the guanine nucleotide-binding protein (G protein)-coupled receptor kinase subfamily of the Ser/Thr protein kinase family. The protein phosphorylates the activated forms of G protein-coupled receptors thus initiating its deactivation. This gene has been linked to both genetic and acquired hypertension. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: LPPVSQCSELRHSIEKDYSSLCDKQPIGRRLFRQFCDT KPTLKRHIEFLDAVAEYEVADDEDRSDCGLSILDRFFN DKLAAPLPEIPPDVVTECRLGLKEENPSKKAFEE Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.