207660-ML490
GCSH (Glycine Cleavage System Protein H (aminomethyl carrier), Lipoic Acid-containing Protein, Mitochondrial glycine cleavage system H-Protein, Part of Mitochondrial Matrix Glycine Cleavage Enzyme Complex of 4 Proteins: H-, L-, P-, and T-Proteins, GCE, NKH) (MaxLight 490)
Größe
£914.00
- SKU:
- 207660-ML490
- Reinheit:
- Purified
- Lagerbedingungen:
- 4°C Do Not Freeze
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Recombinant protein corresponding to aa1-173 from full-length human GCSH with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- M2
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™490.
- Weitere Details:
- MaxLight™490 is a new Blue-Green photostable dye conjugate comparable to DyLight™488, Alexa Fluor™488 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (491nm); Emission (515nm); Extinction Coefficient 73,000. The enzyme system for cleavage of glycine (glycine cleavage system; EC 2.1.2.10), which is confined to the mitochondria, is composed of 4 protein components: P protein (a pyridoxal phosphate-dependent glycine decarboxylase; MIM 238300), H protein (a lipoic acid-containing protein), T protein (a tetrahydrofolate-requiring enzyme; MIM 238310), and L protein (a lipoamide dehydrogenase; MIM 238331). Glycine encephalopathy (GCE; MIM 605899), also called nonketotic hyperglycinemia (NKH), may be due to a defect in any one of these enzymes. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MALRVVRSVRALLCTLRAVPLPAAPCPPRPWQLGVGA VRTLRTGPALLSVRKFTEKHEWVTTENGIGTVGISNFA QEALGDVVYCSLPEVGTKLNKQDEFGALESVKAASEL YSPLSGEVTEINEALAENPGLVNKSCYEDGWLIKMTLS NPSELDELMSEEAYEKYIKSIEE Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice