207660-FITC
GCSH (Glycine Cleavage System Protein H (aminomethyl carrier), Lipoic Acid-containing Protein, Mitochondrial glycine cleavage system H-Protein, Part of Mitochondrial Matrix Glycine Cleavage Enzyme Complex of 4 Proteins: H-, L-, P-, and T-Proteins, GCE, NKH) (FITC)
Größe
£914.00
- SKU:
- 207660-FITC
- Reinheit:
- Purified
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Recombinant protein corresponding to aa1-173 from full-length human GCSH with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- M2
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
- Weitere Details:
- The enzyme system for cleavage of glycine (glycine cleavage system; EC 2.1.2.10), which is confined to the mitochondria, is composed of 4 protein components: P protein (a pyridoxal phosphate-dependent glycine decarboxylase; MIM 238300), H protein (a lipoic acid-containing protein), T protein (a tetrahydrofolate-requiring enzyme; MIM 238310), and L protein (a lipoamide dehydrogenase; MIM 238331). Glycine encephalopathy (GCE; MIM 605899), also called nonketotic hyperglycinemia (NKH), may be due to a defect in any one of these enzymes. Applications: Suitable for use in FLISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MALRVVRSVRALLCTLRAVPLPAAPCPPRPWQLGVGA VRTLRTGPALLSVRKFTEKHEWVTTENGIGTVGISNFA QEALGDVVYCSLPEVGTKLNKQDEFGALESVKAASEL YSPLSGEVTEINEALAENPGLVNKSCYEDGWLIKMTLS NPSELDELMSEEAYEKYIKSIEE Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice