207660-BIOTIN
GCSH (Glycine Cleavage System Protein H (aminomethyl carrier), Lipoic Acid-containing Protein, Mitochondrial glycine cleavage system H-Protein, Part of Mitochondrial Matrix Glycine Cleavage Enzyme Complex of 4 Proteins: H-, L-, P-, and T-Proteins, GCE, NKH) (Biotin)
Größe
£914.00
- SKU:
- 207660-BIOTIN
- Reinheit:
- Purified
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Recombinant protein corresponding to aa1-173 from full-length human GCSH with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- M2
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Weitere Details:
- The enzyme system for cleavage of glycine (glycine cleavage system; EC 2.1.2.10), which is confined to the mitochondria, is composed of 4 protein components: P protein (a pyridoxal phosphate-dependent glycine decarboxylase; MIM 238300), H protein (a lipoic acid-containing protein), T protein (a tetrahydrofolate-requiring enzyme; MIM 238310), and L protein (a lipoamide dehydrogenase; MIM 238331). Glycine encephalopathy (GCE; MIM 605899), also called nonketotic hyperglycinemia (NKH), may be due to a defect in any one of these enzymes. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MALRVVRSVRALLCTLRAVPLPAAPCPPRPWQLGVGA VRTLRTGPALLSVRKFTEKHEWVTTENGIGTVGISNFA QEALGDVVYCSLPEVGTKLNKQDEFGALESVKAASEL YSPLSGEVTEINEALAENPGLVNKSCYEDGWLIKMTLS NPSELDELMSEEAYEKYIKSIEE Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice