207650-BIOTIN
FYN (FYN Oncogene Related to SRC, FGR, YES, OKT3-induced Calcium Influx Regulator, OTTHUMP00000017914, OTTHUMP00000017915, OTTHUMP00000017917, C-syn protoOncogene, Protein-Tyrosine Kinase fyn, Proto-Oncogene Tyrosine-Protein Kinase fyn, Src-like Kinase, Src/yes-Related novel, Tyrosine Kinase p59fyn(T), MGC45350, SLK, SYN) (Biotin)
Größe
£914.00
- SKU:
- 207650-BIOTIN
- Reinheit:
- Purified
- Lagerbedingungen:
- -20°C
- Hersteller:
- United States Biological
- Host:
- Mouse
- Immunogen:
- Recombinant protein corresponding to aa1-90 from human FYN with GST tag. MW of the GST tag alone is 26kD.
- Klon:
- 3A8
- Format:
- Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
- Weitere Details:
- This gene is a member of the protein-tyrosine kinase oncogene family. It encodes a membrane-associated tyrosine kinase that has been implicated in the control of cell growth. The protein associates with the p85 subunit of phosphatidylinositol 3-kinase and interacts with the fyn-binding protein. Alternatively spliced transcript variants encoding distinct isoforms exist. Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MGCVQCKDKEATKLTEERDGSLNQSSGYRYGTDPTP QHYPSFGVTSIPNYNNFHAAGGQGLTVFGGVNSSSHT GTLRTRGGTGVTLFVAL Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Note: Applications are based on unconjugated antibody.
- Versandbedingungen:
- Blue Ice