207604-PE

FASLG (Fas Ligand (TNF Superfamily, Member 6), APT1LG1, CD178, CD95L, FASL, TNFSF6, CD95 Ligand, OTTHUMP00000032708, Apoptosis (APO-1) Antigen Ligand 1, Fas Ligand, Tumor Necrosis Factor (Ligand) Superfamily, Member 6) (PE)

Größe

£914.00

SKU:: 207604-PE
Anwendung:: FLISA
Reinheit:: Purified
Lagerbedingungen:: 4°C Do Not Freeze
Hersteller:: United States Biological
Host:: Mouse
Immunogen:: Recombinant protein corresponding to aa172-281 from human FASLG with GST tag. MW of the GST tag alone is 26kD.
Klon:: 3F3
Format:: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Weitere Details:: The protein encoded by this gene is the ligand for FAS. Both are transmembrane proteins. Interaction of FAS with this ligand is critical in triggering apoptosis of some types of cells such as lymphocytes. Defects in this gene may be related to some cases of systemic lupus erythematosus (SLE). Applications: Suitable for use in FLISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: SGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLS HKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSS YLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL Storage and Stability: Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Note: Applications are based on unconjugated antibody.